| Product name: | Human ST2 antigen |
|---|---|
| Synonym: | Human ST2 Antigen, Human ST2 recombinant protein, Human ST2 protein antigen, Human ST2 Diagnostic antigen, Human ST2 diagnostic reagent, Human ST2s Antigen, Human ST2s recombinant protein, Human ST2s protein antigen, Human ST2s Diagnostic antigen, Human ST2sdiagnostic reagent, Human IL1RL1 Antigen, Human IL1RL1 recombinant protein, Human IL1RL1 protein antigen, Human IL1RL1 Diagnostic antigen, Human IL1RL1diagnostic reagent, DER4, FIT-1, IL33R, ST2, ST2L, ST2V, T1 |
| Product Type: | Recombinant protein antigen |
| Product Category: | Cardiac Markers |
| Catalog: | AG10027 |
| Qty/Pack Size: | 100ug, 1mg |
| Format: | Purified Recombinant Antigen. |
| Source: | Human |
| Express Host: | Hek293 Cells |
| Purity: | >95% |
| Supplied In: | 10 mM Phosphate Buffer, 150 mM Sodium Chloride, pH 7.4 |
| Applications: | ELISA, WB, Immunogen, Lateral Flow, CMIA, Control |
| Storage: |
Short Term (≤ 2 weeks): 2-8°C. Long Term: -20°C. Avoid repeated freezing and thawing.
Recombinant proteins are provided as frozen liquid which are shipped with dry ice.
Bulk packages canbeprovided as lyophilized powder which shipped with blue ice. |
| Construction: | A DNA sequence encoding the Human ST2 Protein was expressed with His-tag in C terminus. |
| Molecular Mass: | The protein of Human ST2 consists of 310 amino acids. |
| Biological Activity: | N/A |
| Endotoxin | N/A |
| Gene ID: | 9173 |
| Gene sequence: | NM_016232.5, Homo sapiens interleukin 1 receptor like 1 (IL1RL1), transcript variant 1, mRNA |
| Protein sequence: | NP_057316.3, interleukin-1 receptor-like 1 isoform 1 precursor [Homo sapiens] |
| Discription: | ST2 is a member of the interleukin-1 receptor/Toll-like receptor superfamily.In 2013, THE ACCF/AHAguidelines included sST2 as a marker of myocardial fibrosis that can predict admission and death inHFpatients. |
| Sequence: |
MGFWILAILTILMYSTAAKFSKQSWGLENEALIVRCPRQGKPSY
TVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANV
TIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYR
AHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPA
QNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSF
SNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPIDHHSIYCIIA
VCSVFLMLINVLVIILKMFWIEATLLWRDIAKPYKTRNDGKLYDAYVVYPRNYKSSTD
GASRVEHFVHQILPDVLENKCGYTLCIYGRDMLPGEDVVTAVETNIRKSRRHIFILTP
QITHNKEFAYEQEVALHCALIQNDAKVILIEMEALSELDMLQAEALQDSLQHLMKVQG
TIKWREDHIANKRSLNSKFWKHVRYQMPVPSKIPRKASSLTPLAAQKQHHHHHH
|
| SDS Page: | -- |
| Note: | This product is intended for research and manufacturing uses only. It is not a diagnostic device. The user assumes all responsibility for care, custody and control of the material, including its disposal, in accordance with all regulations. |
Customers Navigation

ST2s IL1RL1 Product Infomation
- Previous:FDP Antigen
- Next:None